Sequence of CPDP_YERPE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3',5'-cyclic-nucleotide phosphodiesterase
Q8ZD92
Yersinia pestis
343
37874
Reaction
nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q8ZD92|3',5'-cyclic-nucleotide phosphodiesterase|EC 3.1.4.17|Yersinia pestis|Swiss-Prot
MKYLSIKSASDKIKSGLLKTGVILSFSLFSSLSTAAFEVVALGVDGGVSDGNLTSYLIRN
DSQPLYLGLDAGSVLPGIARALEKGHFAAITDAMAAPLTRQGYIFRQSINSYFISHAHLD
HVSGLIIGSPDDSKKTIYASADTIDVLRNYYFNWRVWPNFTDSGSGARLGTYRMQVVRPA
QSLSLGLTRLTGEMYPLSHDKSPSSMLLISSNNEFFAYFGDTGPDDVEKSKNLDTVWRKL
AEKVTQQQLKGMIIEVSYPNDVADNKLFGHMTPTWLLKELKKLEQYSGEGQPLKGLPVVI
SHIKPSFQQGQDVRKLILSELQQGNDMGIEFILMEQGDSQKFQ
Download this sequence
in fasta format
Download all sequences for 3.1.4.17
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
19654
Parkhill J.,Wren B.W.,Thomson N.R.,Titball R.W.,Holden M.T.G.,Prentice M.B.,Sebaihia M.,James K.D.,Churcher C.M.,Mungall K.L.,Baker S.,Basham D.,Bentley S.D.,Brooks K.,Cerdeno-Tarraga A.-M.,Chillingworth T.,Cronin A.,Davies R.M.,Davis P.,Dougan G.,Feltwell T.,Hamlin N.,Holroyd S.,Jagels K.,Karlyshev A.V.,Leather S.,Moule S.,Oyston P.C.F.,Quail M.A.,Rutherford K.M.,Simmonds M.,Skelton J.,Stevens K.,Whitehead S.,Barrell B.G.
Genome sequence of Yersinia pestis, the causative agent of plague.
Nature
413
523-527
2001
19655
Deng W.,Burland V.,Plunkett G. III,Boutin A.,Mayhew G.F.,Liss P.,Perna N.T.,Rose D.J.,Mau B.,Zhou S.,Schwartz D.C.,Fetherston J.D.,Lindler L.E.,Brubaker R.R.,Plano G.V.,Straley S.C.,McDonough K.A.,Nilles M.L.,Matson J.S.,Blattner F.R.,Perry R.D.
Genome sequence of Yersinia pestis KIM.
J. Bacteriol.
184
4601-4611
2002
19656
Song Y.,Tong Z.,Wang J.,Wang L.,Guo Z.,Han Y.,Zhang J.,Pei D.,Zhou D.,Qin H.,Pang X.,Han Y.,Zhai J.,Li M.,Cui B.,Qi Z.,Jin L.,Dai R.,Chen F.,Li S.,Ye C.,Du Z.,Lin W.,Wang J.,Yu J.,Yang H.,Wang J.,Huang P.,Yang R.
Complete genome sequence of Yersinia pestis strain 91001, an isolate avirulent to humans.
DNA Res.
11
179-197
2004