Sequence of LOXA_PSEAE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
arachidonate 15-lipoxygenase
Q9I4G8
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
685
74804
Reaction
arachidonate + O2 = (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9I4G8|arachidonate 15-lipoxygenase|EC 1.13.11.33|Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)|Swiss-Prot
MKRRSVLLSGVALSGTALANDSIFFSPLKYLGAEQQRSIDASRSLLDNLIPPSLPQYDNL
AGKLARRAVLTSKKLVYVWTENFGNVKGVPMARSVPLGELPNVDWLLKTAGVIVELIVNF
VASLPASAAAQFERIATGLSGDLEAARQVHEALLEEAKNDPAAAGSLLLRFTELQTRVIA
ILTRVGLLVDDILKSASNLVTQRGQGDGLNRFRAVFGTLRLPEVADSFRDDEAFAYWRVA
GPNPLLIRRVDALPANFPLGEEQFRRVMGADDSLLEAAASRRLYLLDYAELGKLAPSGAV
DKLLTGTGFAYAPIALFALGKDRARLLPVAIQCGQDPATHPMFVRPAESESDLYWGWQMA
KTVVQVAEENYHEMFVHLAQTHLVSEAFCLATQRTLAPSHPLHVLLAPHFEGTLFINEGA
ARILLPSAGFIDVMFAAPIQDTQATAGGNRLGFDFYRGMLPESLKARNVDDPLALPDYPY
RDDGLLVWNAIRQWAADYVAVYYASDGDVTADVELAAWVGEVIGSGKVAGFRPITGRSQL
VEVLTMVIFTASAQHAAVNFPQPSMMTYAPAICAMSAAPAPDSPSGKSEADWLKMMPPTL
VALEKVNIYHLLGSVYHGRLGDYRQTGFPYAPVFSDRRVTASGGPLERFQARLKEVEATI
RTRNQARRRPYEYLLPSRIPASTNI
Download this sequence
in fasta format
Download all sequences for 1.13.11.33
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
177817
Stover C.K.,Pham X.-Q.T.,Erwin A.L.,Mizoguchi S.D.,Warrener P.,Hickey M.J.,Brinkman F.S.L.,Hufnagle W.O.,Kowalik D.J.,Lagrou M.,Garber R.L.,Goltry L.,Tolentino E.,Westbrock-Wadman S.,Yuan Y.,Brody L.L.,Coulter S.N.,Folger K.R.,Kas A.,Larbig K.,Lim R.M.,Smith K.A.,Spencer D.H.,Wong G.K.-S.,Wu Z.,Paulsen I.T.,Reizer J.,Saier M.H. Jr.,Hancock R.E.W.,Lory S.,Olson M.V.
Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen.
Nature
406
959-964
2000
177818
Vance R.E.,Hong S.,Gronert K.,Serhan C.N.,Mekalanos J.J.
The opportunistic pathogen Pseudomonas aeruginosa carries a secretable arachidonate 15-lipoxygenase.
Proc. Natl. Acad. Sci. U.S.A.
101
2135-2139
2004
177819
Morello E.,Perez-Berezo T.,Boisseau C.,Baranek T.,Guillon A.,Brea D.,Lanotte P.,Carpena X.,Pietrancosta N.,Herve V.,Ramphal R.,Cenac N.,Si-Tahar M.
Pseudomonas aeruginosa Lipoxygenase LoxA contributes to lung infection by altering the host immune lipid signaling.
Front. Microbiol.
10
1826-1826
2019
177820
Banthiya S.,Kalms J.,Galemou Yoga E.,Ivanov I.,Carpena X.,Hamberg M.,Kuhn H.,Scheerer P.
Structural and functional basis of phospholipid oxygenase activity of bacterial lipoxygenase from Pseudomonas aeruginosa.
Biochim. Biophys. Acta
1861
1681-1692
2016