Sequence of IP3KC_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
inositol-trisphosphate 3-kinase
Q80ZG2
Rattus norvegicus
678
74463
Reaction
ATP + 1D-myo-inositol 1,4,5-trisphosphate = ADP + 1D-myo-inositol 1,3,4,5-tetrakisphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q80ZG2|inositol-trisphosphate 3-kinase|EC 2.7.1.127|Rattus norvegicus|Swiss-Prot
MRRCPCRGSLSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPEGGGPRA
WIEGFSLHSEAERTDFGPAPCPDGPQAEPCGDEHEECEAAGLGVASEKPSQNKELDGSNL
QTHPKLSSPLAEMEMAGSWTDGFRTDLHRPDLQARPKRASLCTQPGFDESWTELDRSELW
QTLPERDKPWVDHLRTHQDMSRLQNHPACPSPEPSAGTSCKELSADGSRTPHDTDGFWIE
SQTDGSLIGPSTQTACRQPANDGFSAQDTDGTLIQPGTDDGPWVDSVLEKSNGDDPLMEP
EPRDLVTNLCSHLECSSLCPVPRLIITSESPEPGAQPLGPQARIEGGTGGFSSASSFDES
EDDLVAGGGGTSDPEDRSGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGE
DGRILKRFCQCEQRSLELLMGDPLRPFVPTYYGMVQRDGQAFNQMEDLLADFEGPSIMDC
KMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETLS
STSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVNGDVGILRKYVARLEDLRDT
LENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWAEGNREDG
YLWGLDNLICLLQGLAQS
Download this sequence
in fasta format
Download all sequences for 2.7.1.127
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
171690
Nalaskowski M.M.,Bertsch U.,Fanick W.,Stockebrand M.C.,Schmale H.,Mayr G.W.
Rat inositol 1,4,5-trisphosphate 3-kinase C is enzymatically specialized for basal cellular inositol trisphosphate phosphorylation and shuttles actively between nucleus and cytoplasm.
J. Biol. Chem.
278
19765-19776
2003
171691
Lundby A.,Secher A.,Lage K.,Nordsborg N.B.,Dmytriyev A.,Lundby C.,Olsen J.V.
Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.
Nat. Commun.
3
876-876
2012