Sequence of HYEP_MANSE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
microsomal epoxide hydrolase
Q25489
Manduca sexta
462
52612
Reaction
1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-({[(4-methoxyphenyl)methyl](methyl)amino}methyl)-2-methylpropane-1,3-diol
Sequences with same EC No.
Sequence
show sequence in normal format
>Q25489|microsomal epoxide hydrolase|EC 3.3.2.9|Manduca sexta|Swiss-Prot
MYKILSSFVAGVAIGSGLVITYVLYNVPEPPELDLQRWWGIGTRPTEEDKSIRPFSIDFN
DTVILDLKERLKNRRPFTKPLEGINSEYGMNTEYLETVLEYWLNEYNFKKRAELLNKFPH
YKTRIQGLDLHFIRVKPEIKEGVQVLPLLMMHGWPSSSKEFDKVIPILTTPKHEYNIVFE
VVAVDLPGYGFSEGTNKPGLNPVQIGVMMRNLMLRLGFEKFYIQAGDWGSQCATHMATLF
PDQVLGLHTNMPLSSRPLSTVKLFIGALFPSLIVDAKYMDRIYPLKNLFSYILRETGYFH
IQATKPDTIGVALTDSPAGLAGYLIEKMAICSNRDQLDTPHGGLENLNLDDVLDTVTINW
INNCIVTSTRLYAEGFSWPEVLIVHRIPSMVPTAGINFKYEVLYQPDWILRDKFPNLVRS
TVLDFGGHFAALHTPQALADDIFASAVQFLKFHDRKRNQKSS
Download this sequence
in fasta format
Download all sequences for 3.3.2.9
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
166089
Wojtasek H.,Prestwich G.D.
An insect juvenile hormone-specific epoxide hydrolase is related to vertebrate microsomal epoxide hydrolases.
Biochem. Biophys. Res. Commun.
220
323-329
1996