Sequence of Q7LXP1_SACS2

EC Number:2.7.1.165

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycerate 2-kinase
Q7LXP1
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
400
44415
Reaction
ATP + D-glycerate = ADP + 2-phospho-D-glycerate
Other sequences found for EC No. 2.7.1.165

General information:

Sequence
show sequence in normal format
>|glycerate 2-kinase|EC 2.7.1.165||
MDIVDKILEYTDPYKALQEKVRVYNNILLFNNEKIPFKKPILISIGKASLPMARFFRERM
ELKAKLIVTPKGTNGKENDVIEAGHPLPDENSIKAGKRMIELLANEDYDLVIFAISGGAS
ALVEYSEIPLDELKIINKVLVTSGLGINKINIVRKHLSKVKGGKILEYVKDKIPIVSFIV
SDVPGNDISSIGSGLTSIDNSSNDDALEILKAIGLEKYSKYLTETPKSFSRIVKNYIILD
NMEVLRKLANTLVNSFILTSEIRGEARDVGAIIASIYNSSESYNIPFRRPYYLLVGGEPE
VTIQGKAGKGGRNGEVCLSFLKYAKKRNRFELLGFATDGIDGNSEYAGCKVSSDMEIRED
EINNALETHNSYGLLESHKAVIKTGYTHTNVNNIYVLRAP
Download this sequence
in fasta format
Download all sequences for 2.7.1.165
in fasta format
in csv (Excel, OpenOffice) format