Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of I23O2_HUMAN

EC Number:1.13.11.52

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
indoleamine 2,3-dioxygenase
Q6ZQW0
Homo sapiens
420
47075
Reaction
L-tryptophan + O2 = N-formyl-L-kynurenine
Other sequences found for EC No. 1.13.11.52

General information:

Sequence
show sequence in normal format
>|indoleamine 2,3-dioxygenase|EC 1.13.11.52||
MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA
NKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVL
PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGF
ILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDP
DIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYH
ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
Download this sequence
in fasta format
Download all sequences for 1.13.11.52
in fasta format
in csv (Excel, OpenOffice) format