Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of PUUC_ECOLI

EC Number:1.2.1.99

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
4-(gamma-glutamylamino)butanal dehydrogenase
P23883
Escherichia coli (strain K12)
495
53419
Reaction
4-(gamma-L-glutamylamino)butanal + NAD(P)+ + H2O = 4-(gamma-L-glutamylamino)butanoate + NAD(P)H + H+
Other sequences found for EC No. 1.2.1.99

General information:

Sequence
show sequence in normal format
>|4-(gamma-glutamylamino)butanal dehydrogenase|EC 1.2.1.99||
MNFHHLAYWQDKALSLAIENRLFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDID
RAMSAARGVFERGDWSLSSPAKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDD
IPGAARAIRWYAEAIDKVYGEVATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGP
ALAAGNSVILKPSEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAI
AFTGSTRTGKQLLKDAGDSNMKRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQ
VCIAGTRLLLEESIADEFLALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREG
ESKGQLLLDGRNAGLAAAIGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLAND
SQYGLGAAVWTRDLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHAL
EKFTELKTIWISLEA
Download this sequence
in fasta format
Download all sequences for 1.2.1.99
in fasta format
in csv (Excel, OpenOffice) format