Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of Q97XS9_SACS2

EC Number:1.2.1.24

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
succinate-semialdehyde dehydrogenase (NAD+)
Q97XS9
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
470
51530
Reaction
succinate semialdehyde + NAD+ + H2O = succinate + NADH + H+
Other sequences found for EC No. 1.2.1.24

General information:

Sequence
show sequence in normal format
>Q97XS9|succinate-semialdehyde dehydrogenase (NAD+)|EC 1.2.1.24|Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)|TrEMBL
MMSQEVIEVRSPSNLNVIGTVKRMHKDEVRGEIEEAYKGFEIISKMPLYKRTAILRKVSE
ILEREQERLAKLLAMEAGKPIRDSRVEVLRASRLFRHAAEEVGMVLEGKNYRVDAYEYPP
GNENRIVVSTREPIGVVTAILPFNFPINSFAHKVAPALAVGNSVVVKPSINTPLAAIEMK
KILVEAGLPDSAVRVVTGYSSEIGDEIITHPLVGLITLTGSTQTGLKIASKAVSLGKRII
MELGGSDPIIILEDANIERASSIAVRARFEYAGQNCNAGKRIIVREEIYDKFVKAFNDKA
RALKVGDPLDETTDVGPVINKESVENLNSVLADAKAKGGKVEILNKGPESGSFFPLTMVT
NPSLDMLVLKSEVFGPIVPIVSVKSDEEAIRIANSTEYGLQSAIFTNDVNRALKLSRELK
FGAVIINDSTRLRWDSLAFGGFKKSSIGREGVRETMLEMTENKLIAITLL
Download this sequence
in fasta format
Download all sequences for 1.2.1.24
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
96702530
She Q.,Singh R.K.,Confalonieri F.,Zivanovic Y.,Allard G.,Awayez M.J.,Chan-Weiher C.C.-Y.,Clausen I.G.,Curtis B.A.,De Moors A.,Erauso G.,Fletcher C.,Gordon P.M.K.,Heikamp-de Jong I.,Jeffries A.C.,Kozera C.J.,Medina N.,Peng X.,Thi-Ngoc H.P.,Redder P.,Schenk M.E.,Theriault C.,Tolstrup N.,Charlebois R.L.,Doolittle W.F.,Duguet M.,Gaasterland T.,Garrett R.A.,Ragan M.A.,Sensen C.W.,Van der Oost J.
The complete genome of the crenarchaeon Sulfolobus solfataricus P2.
Proc. Natl. Acad. Sci. U.S.A.
98
7835-7840
2001