Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of O07461_RHOPL

EC Number:1.3.7.8

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
benzoyl-CoA reductase
O07461
Rhodopseudomonas palustris
436
49664
Reaction
cyclohexa-1,5-diene-1-carbonyl-CoA + oxidized ferredoxin + 2 ADP + 2 phosphate = benzoyl-CoA + reduced ferredoxin + 2 ATP + 2 H2O
Other sequences found for EC No. 1.3.7.8

General information:

Sequence
show sequence in normal format
>O07461|benzoyl-CoA reductase|EC 1.3.7.8|Rhodopseudomonas palustris|TrEMBL
MTVIVGPKTKPPEAIKDASMARQKQMVNAHYDRLASAKERGEKVAATFVPGNLNELLMCF
DMVNNLPEVNAIQNGLRRQSGGYVMEAEKLGHSEDVCTYVKSDIGMMAKGNIGPNGKPLP
DPDVLLLSYTGCFTFMKWFELLRRQYKCETIMFQTPYLADGRITKDMISYMVKQLRQDVI
PKLERISGVKFDIDRLREYLRKSAKAEDDHVWVLQSAKHKPSPIDAYFGGIYYIGPIFGA
FRGTDDAIEYYKFLRAEVEQRIAQGKGPVTPDGDMGQERYRLVVEGPPNYTNFRQFWKMF
YDEGAVVVASSYTKVGGTYDYGFRHDPDRPLESLAEYCLNVYTNRNLPMRVDMLENYINE
YEADGLLINSIKSCNSFSAGQLLMMREVEKRTGKPAAFIETDLVDPRYFSAANVKNRLES
YFQMIEQKRAGFRGAA
Download this sequence
in fasta format
Download all sequences for 1.3.7.8
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
53150250
Egland P.G.,Pelletier D.A.,Dispensa M.,Gibson J.,Harwood C.S.
A cluster of bacterial genes for anaerobic benzene ring biodegradation.
Proc. Natl. Acad. Sci. U.S.A.
94
6484-6489
1997
53150251
Pelletier D.A.,Harwood C.S.
2-Ketocyclohexanecarboxyl coenzyme A hydrolase, the ring cleavage enzyme required for anaerobic benzoate degradation by Rhodopseudomonas palustris.
J. Bacteriol.
180
2330-2336
1998