Sequence of A0A0C2AGI1_9ACTN

EC Number:3.5.1.103

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
A0A0C2AGI1
Streptomyces sp. AcH 505
304
32209
Reaction
1-O-(2-acetamido-2-deoxy-alpha-D-glucopyranosyl)-1D-myo-inositol + H2O = 1-O-(2-amino-2-deoxy-alpha-D-glucopyranosyl)-1D-myo-inositol + acetate
Other sequences found for EC No. 3.5.1.103

General information:

Sequence
show sequence in normal format
>|N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase|EC 3.5.1.103||
MSDLPGRRLMLVHAHPDDETINNGATMAKYAAGGALVTLVTCTLGEEGEVVPAALARLAA
DKDDALGPHRVGELAAAMRELGVTDHRFLGGAGRYRDSGMMGLPQNDRENAFWHTDVEAA
APYLVEMIREVRPQVLVTYDPDGGYGHPDHIQAHRVATRAAELAADAAYRADLGAPHTVA
KVYWNRMPRSVAEAGFARLRAAGPVFAGTATVDDLPGVVDDARITTVVDGAEYAGRKTAA
MRAHATQITVHGPFFALSNDLGQPLFAQEYYELVQGERGAPAGERETDLFAGIAGAEATA
GAGR
Download this sequence
in fasta format
Download all sequences for 3.5.1.103
in fasta format
in csv (Excel, OpenOffice) format