Sequence of A0A3N6GNC2_9ACTN

EC Number:3.6.3.17

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
monosaccharide-transporting ATPase
A0A3N6GNC2
Streptomyces sp. ADI97-07
516
56669
Reaction
Other sequences found for EC No. 3.6.3.17

General information:

Sequence
show sequence in normal format
>|monosaccharide-transporting ATPase|EC 3.6.3.17||
MAGPVLEMRSIVKTFPGVKALSDVTLTVRQGEVHAICGENGAGKSTLMKVLSGVHPHGSY
EGDVLFEEETCRFKDIRASEQHGIVIIHQELALVPYLSIAENIFLGNEHAKRGLINWNET
LRHATELLRRVGLAENPETRVADIGVGKQQLVEIAKALSKKVKLLILDEPTAALNDEDSG
KLLDLILSLKDQGMTSIIISHKLNEIRRVADSVTIIRDGHSIETLDVKAPETTEDRIISG
MVGRDLENRFPERTPHHPEEGTAPALEIRNWTVHHPIDQQRKVVDDVSIEVRRGEIVGIA
GLMGAGRTELAMSVFGRSYGRYAGGTVLRDGTEIRTKSVPEAVGHGIAYATEDRKHYGLN
LIDTINRNISLTALGKVAKRGVVDEHGERQVAEGFRKSMNIKAPTVFEPVGKLSGGNQQK
VVLSKWIFAGPEVLILDEPTRGIDVGAKYEIYTVIDQLAAQGKAVVFISSELPELLGMCD
RIYTMAAGRLTGEFSRAEASQEALMRQMTKDKEVTR
Download this sequence
in fasta format
Download all sequences for 3.6.3.17
in fasta format
in csv (Excel, OpenOffice) format