Sequence of A0A380AST3_SHIFL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycolaldehyde dehydrogenase
A0A380AST3
Shigella flexneri
681
72945
Reaction
glycolaldehyde + NAD+ + H2O = glycolate + NADH + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A380AST3|glycolaldehyde dehydrogenase|EC 1.2.1.21|Shigella flexneri|TrEMBL
MQQLASFLSGTWQSGRGRSRLIHHAISGEALWEVTSEGLGMAAARQFAIEKGAPALRAMT
FIERAAMLKAVAKHLLSEKERFYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPD
DTLWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEKLAPTWLGGMPAII
KPATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQML
RVQPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRR
IIVPQALVNAVSDALVARLQKVVVGDPAQEGVKMGALVNAEQRADVQEKVNILLAAGCEI
RLGGQADLSAAGAFFPPTLLYCPQPDETPAVHATEAFGPVATLMPAQNQRHALQLACAGG
GSLAGTLVTADPQIARQFIADAARTHGRIQILNEESAKESTGHGSPLPQLVHGGPGRAGG
GEELGGLRAVKHYMQRTAVQGSPTMLAAISKQWVRGAKVEEDRIHPFRKYFEELQPGDSL
LTPRRTMTEADIVNFACLSGDHFYAHMDKIAAAESIFGERVVHGYFVLSAAAGLFVDAGV
GPVIANYGLESLRFIEPVKPGDTIQVRLTCKRKTLKKQRSAEEKPTGVVEWAVEVFNQHQ
TPVALYSILTLVARQHGDFVD
Download this sequence
in fasta format
Download all sequences for 1.2.1.21
in fasta format
in csv (Excel, OpenOffice) format