Sequence of ENTP8_MOUSE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
apyrase
Q8K0L2
Mus musculus
497
54650
Reaction
a nucleoside 5'-diphosphate + H2O = a nucleoside 5'-phosphate + phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q8K0L2|apyrase|EC 3.6.1.5|Mus musculus|Swiss-Prot
MGLSWKERVFMALLGVAAASGLTMLVLILVKAINVLLPADTKFGIVFDAGSSHTSLFVYQ
WPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCLEEALALIPQAQHPETPT
FLGSTAGMRLLSQKNSSQARDILAAVSQTLSKSPVDFWGAKILAGQDEGAFGWITINYVL
GMLLKYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYT
HSYLCFGRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQAILPLSSLYDSPCIHTTDS
LNHTQNLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYT
FHFLNLTSRQSLNTVNDTVWKFCQKPWKLVEVSYPGQERWLRDYCASGLYILVLLLEGYK
FSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAPTHWRAQSYSIWTAGVVFAVLT
LVAILGAAAIQIFWTQD
Download this sequence
in fasta format
Download all sequences for 3.6.1.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
154493
Bigonnesse F.,Levesque S.A.,Kukulski F.,Lecka J.,Robson S.C.,Fernandes M.J.,Sevigny J.
Cloning and characterization of mouse nucleoside triphosphate diphosphohydrolase-8.
Biochemistry
43
5511-5519
2004
154494
Church D.M.,Goodstadt L.,Hillier L.W.,Zody M.C.,Goldstein S.,She X.,Bult C.J.,Agarwala R.,Cherry J.L.,DiCuccio M.,Hlavina W.,Kapustin Y.,Meric P.,Maglott D.,Birtle Z.,Marques A.C.,Graves T.,Zhou S.,Teague B.,Potamousis K.,Churas C.,Place M.,Herschleb J.,Runnheim R.,Forrest D.,Amos-Landgraf J.,Schwartz D.C.,Cheng Z.,Lindblad-Toh K.,Eichler E.E.,Ponting C.P.
Lineage-specific biology revealed by a finished genome assembly of the mouse.
PLoS Biol.
7
0-0
2009
154495
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004