Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of CBK_TRIVA

EC Number:2.7.2.2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carbamate kinase
O96432
Trichomonas vaginalis
314
33927
Reaction
ATP + carbamate = ADP + carbamoyl phosphate
Other sequences found for EC No. 2.7.2.2

General information:

Sequence
show sequence in normal format
>O96432|carbamate kinase|EC 2.7.2.2|Trichomonas vaginalis|Swiss-Prot
MRIVVALGGNALLQRGMKGTFQDQQAACRLAMSQIVKIVKDGNELVMTHGNGPQCGAIFL
QNVAGEQEKVPAMPLHVCGAETQGFLGELLQQELDGALRAEGIKKNVVSIVTQSFVDPKD
PAFQNPTKPIGPFYSKEEAEFLRNERGYNMVEDAGRGYRMIVPSPVPQKFVEKEAIKTLV
NSGFIVVCSGGGGIPVILDEQENRIEGVDAVIDKDLGASVLAAATNADAFMILTDVPEAL
LNYRKENETAIRQATVAEMEKYIEEGHFIKGSMLPKVQACLRFVKSTGKPALITALDCAL
QALKGERGTKIVPN
Download this sequence
in fasta format
Download all sequences for 2.7.2.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
14070
Minotto L.,Edwards M.R.,Bagnara A.S.
Trichomonas vaginalis: characterization, expression, and phylogenetic analysis of a carbamate kinase gene sequence.
Exp. Parasitol.
95
54-62
2000