Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of Q58P26_ENTHI

EC Number:4.1.1.17

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ornithine decarboxylase
Q58P26
Entamoeba histolytica
413
46432
Reaction
L-ornithine = putrescine + CO2
Other sequences found for EC No. 4.1.1.17

General information:

Sequence
show sequence in normal format
>Q58P26|ornithine decarboxylase|EC 4.1.1.17|Entamoeba histolytica|TrEMBL
MKQTSLEVKEFALNLISQFEPENQPLGFWIFDTEGVEKAVERWKKNMPTVRPCFAVKCNP
EPHLVKLLGELGCGFDCASLNEIKEVLDLGFNPEDITYSQTFKPYNQLIEASHLGINHTI
VDSIDEVQKIAKYAPKMGIMIRIMENDTSAGHVFGEKFGLHDDEVEIVLKEIKDKGLNLD
GVHFHVGSDSHNSEVFTKALTKARNTVTLAEQFGMKPYLIDIGGGFSQVAPFEEFAATIE
KTIKELEFPERTRFIAEPGRYMASNAFHLVSSLHGKRVRIQNGKKQIEYTSGDGLHGSFG
CCIWFEKQKSCECITQKVNENTKMYESIIYGPSCNGSDKVATQELPEMEPGKDWLLFPNM
GAYTISMATNFNGFEERNHVIYTLPLKSTKIIQIPKSIECNSVPSLNGIPHYA
Download this sequence
in fasta format
Download all sequences for 4.1.1.17
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
227340454
Loftus B.J.,Anderson I.,Davies R.,Alsmark U.C.,Samuelson J.,Amedeo P.,Roncaglia P.,Berriman M.,Hirt R.P.,Mann B.J.,Nozaki T.,Suh B.,Pop M.,Duchene M.,Ackers J.,Tannich E.,Leippe M.,Hofer M.,Bruchhaus I.,Willhoeft U.,Bhattacharya A.,Chillingworth T.,Churcher C.M.,Hance Z.,Harris B.,Harris D.,Jagels K.,Moule S.,Mungall K.L.,Ormond D.,Squares R.,Whitehead S.,Quail M.A.,Rabbinowitsch E.,Norbertczak H.,Price C.,Wang Z.,Guillen N.,Gilchrist C.,Stroup S.E.,Bhattacharya S.,Lohia A.,Foster P.G.,Sicheritz-Ponten T.,Weber C.,Singh U.,Mukherjee C.,El-Sayed N.M.A.,Petri W.A.,Clark C.G.,Embley T.M.,Barrell B.G.,Fraser C.M.,Hall N.
The genome of the protist parasite Entamoeba histolytica.
Nature
433
865-868
2005
227340457
Preeti,Tapas S.,Kumar P.,Madhubala R.,Tomar S.
Structural insight into DFMO resistant ornithine decarboxylase from Entamoeba histolytica: an inkling to adaptive evolution.
PLoS ONE
8
0-0
2013