Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of Q8NJ21_KLULC

EC Number:1.2.1.95

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-2-aminoadipate reductase
Q8NJ21
Kluyveromyces lactis
1384
153569
Reaction
(S)-2-amino-6-oxohexanoate + NADP+ + AMP + diphosphate = L-2-aminoadipate + NADPH + H+ + ATP
Other sequences found for EC No. 1.2.1.95

General information:

Sequence
show sequence in normal format
>|L-2-aminoadipate reductase|EC 1.2.1.95||
MSALKDWAIKLDNPTISVLPHDFLRPQQQPLVKQESLSFQLPQLEVPHGRDPYTIILAAW
ASIIYRLTGDDDMVLLVRGAKAIRFTIQATWSFTELYDVVSNELETVKSLESVNFDELSE
HVKAQNELEVLPQFFRLGFVDQEDFSLTTYQNSLLDTVLTLNSSNQLQIVYNSLLYSKDR
ITILVDQITQFVSHVLKDDTTSITKITLITELSKSSIPDPTKNLGWCDFRGCIHDIFQDN
AEKFPERTCVVETPASGQSESRLFTYEQINYDSNIIAHYLINTGIKRGDIVMIYSSRGVD
LMCCVMGVLKAGATFSVIDPAYPPARQTVYLDVAKPKGLVVIRAAGDRQFVEDFIAKELE
VVSRIPSIAIQNDGSIEGGKLQNEENDCLAPYEGLKDKRTGVVVGPDSNPTLSFTSGSEG
IPKGVLGRHFSLAYYFDWMAKEFSLSENDKFTMLSGIAHDPIQRDMFTPLFLGAQLLVPT
QDDIGTPGQLASWMAKYGATVTHLTPAMGQLLAAQATTPFPKLHHAFFVGDILTKRDCLR
LQTLAENVNIINMYGTTETQRAVSYFTVKSRSEDPQFLQKLKDVIPAGKGMYNVQLLVVN
RHDRTQICGVGEVGEIYVRAGGLAAEYRGLPEANKEKFINNWFVEEGHWKSLDKDNGEPW
REFWLGPRDRLYRTGDLGRYLPDGNAECCGRADDQVKIRGFRIELGEIDTHISQYPLVRE
NITLVRNNGDGEKTLITFMVPRFDKPEELSKLSSEVPEIVSKDPVVRGLIGYRHLVKEIK
EFLKKRLANYAIPTVIVVLDKLPLNPNGKVDKPKLQFPTAKQLNLVAENSSVEIDDSEFT
ETEREVRDLWLGVLPSRPATISPEDSFFDLGGHSILATRMIFGLRSTLEVELPLGTIFKY
PTIRAFAGEVDRVKNSSSSEGDEIKTADYANDAKKLVDSMLPTEYPSREAFADPESLSAK
KNINVFVTGVTGFLGSYILADLLNRPTSSYNIKVFAHVRAKTEAAGFNRLKQAGITYGTW
SDSFINRIEVVLGDLSKEKFGLPEGTWSNLVNEIDVIIHNGALVHWVYPYSKLRDPNVVA
TVNVMSLAASGKAKYFTFVSSTSTIDTEHYFSLSDKLVSEGKSGILEADDLSGSAVGLTS
GYGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGASSNGSSNTDDFLLRFLKGVVQLGQIP
NISHTVNMVPVDHVARVVTASAFNPPNEHELAVAHVTGHPRILFKDYLYQLKKYGYNVEI
QEYADWKLSLEHSVIARGEDNALYPLLHMVLDGLAENTRAPELDDTNATSSLQKDKKWTG
VDVSSGKGATPEQIGIYIAFLNKVGFLPPPPTTGELNLPQISLSEEQIKLVSSGAGARSS
SAAA
Download this sequence
in fasta format
Download all sequences for 1.2.1.95
in fasta format
in csv (Excel, OpenOffice) format