Sequence of A0A1D8N683_YARLL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3-hydroxyanthranilate 3,4-dioxygenase
A0A1D8N683
Yarrowia lipolytica
171
19550
Reaction
3-hydroxyanthranilate + O2 = 2-amino-3-carboxymuconate semialdehyde
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1D8N683|3-hydroxyanthranilate 3,4-dioxygenase|EC 1.13.11.6|Yarrowia lipolytica|TrEMBL
MLQEPINLPKWLEENQHLLKPPVNNFCIQRGGYTVMIVGGPNARTDYHINQTPEWFHQKK
GHMTLKVVDDGEFRDITINEGDIFLLPANVPHNPVRYADTIGVVVEQDRPEGMKDALRWY
CPNEKCREIVFENSFQLVDLGTQIKEAILDFDGDIEKRTCKACGTVATSRP
Download this sequence
in fasta format
Download all sequences for 1.13.11.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1625895
Magnan C.,Yu J.,Chang I.,Jahn E.,Kanomata Y.,Wu J.,Zeller M.,Oakes M.,Baldi P.,Sandmeyer S.
Sequence Assembly of Yarrowia lipolytica Strain W29/CLIB89 Shows Transposable Element Diversity.
PLoS ONE
11
0-0
2016