Sequence of ASTG_PSEAE

EC Number:2.3.1.109

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
arginine N-succinyltransferase
P80358
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
340
37245
Reaction
succinyl-CoA + L-arginine = CoA + N2-succinyl-L-arginine
Other sequences found for EC No. 2.3.1.109

General information:

Sequence
show sequence in normal format
>|arginine N-succinyltransferase|EC 2.3.1.109||
MIVRPVTSADLPALIELARSTGTGLTTLPANEQRLQHRVSWAEKAFRGEAERGDADYLFV
LEDDAGKVVGISAIAGAVGLREPWYNYRVGLTVSASQELNIHREIPTLFLANDLTGNSEL
CSLFLHADHRSGLNGKLLSRARFLFIAEFRHLFGDKLIAEMRGMSDEEGRSPFWESLGRH
FFKMEFSQADYLTGVGNKAFIAELMPKFPLYTCFLSEEARGVIGRVHPNTEPALAMLKAE
GFSYQGYVDIFDAGPAIEAETDKIRAIAESQNLVLAVGTPGDDAEPYLIHNRKREDCRIT
AAPARAAAGTLVVDPLTAKRLRLSAGASVRAVPLSAQKRG
Download this sequence
in fasta format
Download all sequences for 2.3.1.109
in fasta format
in csv (Excel, OpenOffice) format