Sequence of AMYB_HORVS

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
beta-amylase
P82993
Hordeum vulgare subsp. spontaneum
535
59639
Reaction
Hydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive maltose units from the non-reducing ends of the chains
Sequences with same EC No.
Sequence
show sequence in normal format
>P82993|beta-amylase|EC 3.2.1.2|Hordeum vulgare subsp. spontaneum|Swiss-Prot
MEVNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGK
GPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIF
YTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLG
PAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTP
ERTQFFRDNGTYLTEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWW
YKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEEL
VQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLS
NQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAKPKLQPFPF
QEHTDLPVGPTGGMGGQAEGPTCGMGGQVKGPTGGMGGQAEDPTSGMGGELPATM
Download this sequence
in fasta format
Download all sequences for 3.2.1.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
132108
Erkkila M.J.,Leah R.,Ahokas H.,Cameron-Mills V.
Allele-dependent barley grain beta-amylase activity.
Plant Physiol.
117
679-685
1998