Sequence of A0A418SK10_9RHOB

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carbazole 1,9a-dioxygenase
A0A418SK10
Rhodobacteraceae bacterium Lw-13e
350
39572
Reaction
9H-carbazole + NAD(P)H + H+ + O2 = 2'-aminobiphenyl-2,3-diol + NAD(P)+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A418SK10|carbazole 1,9a-dioxygenase|EC 1.14.12.22|Rhodobacteraceae bacterium Lw-13e|TrEMBL
MDKASGTRDRVDDYINKGLRGFWVPVAVSVQVQTGKPFATRIAGENLVMWRDGAGKVRCV
EDFCPHRGAKLSLGEVQDGNIACRYHGVSVDGTGTVARVPAMPNCALEGRKALTAYSCEE
AGNAIFIYLPSADRPEAPAFEPPEEFTNGEWEVFPCMTRWDCSYRLSLDNAADPMHAIYL
HSDSFTLSYGAKQDTMNLERTEDGFRIERMGQKGVNLDETEVVMDEGMMYFRLDIPYPDG
AGPGGPFRIIGFATAIDDDTHHSFFWRCRKVTGLAAESWRFLYRAFLEDRHWFVLEQDRN
MLESIPSDARRREMLYQHDIGVSRLRQLMVRRAKEHFKALDAAEADKKSA
Download this sequence
in fasta format
Download all sequences for 1.14.12.22
in fasta format
in csv (Excel, OpenOffice) format