Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of LOX_NOSS1

EC Number:1.2.3.5

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glyoxylate oxidase
Q8Z0C8
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
365
39165
Reaction
glyoxylate + H2O + O2 = oxalate + H2O2
Other sequences found for EC No. 1.2.3.5

General information:

Sequence
show sequence in normal format
>Q8Z0C8|glyoxylate oxidase|EC 1.2.3.5|Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)|Swiss-Prot
MTAISSPINLFEYEQLAKTHLSQMAFDYYISGAGDEITLQENRAVFERIKLRPRMLVDVS
QINLTTSVLGQPLQLPLLIAPMAFQCLAHTEGELATAMAAASAGTGMVLSTLSTKSLEEV
AEVGSKFSPSLQWFQLYIHKDRGLTRALVERAYAAGYKALCLTVDAPVLGQRERDRRNEF
VLPPGLHLANLTTISGLNIPHAPGESGLFTYFAQQLNPALTWDDLEWLQSLSPLPLVLKG
ILRGDDAARAVEYGAKAIVVSNHGGRQLDGAIASLDALPEIVAAVNGKAEVLLDGGIRRG
TDIIKALAIGAQAVLIGRPVLWGLAVGGQAGVSHVISLLQKELNVAMALIGCSQLQDIDT
SFLHL
Download this sequence
in fasta format
Download all sequences for 1.2.3.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1208965
Kaneko T.,Nakamura Y.,Wolk C.P.,Kuritz T.,Sasamoto S.,Watanabe A.,Iriguchi M.,Ishikawa A.,Kawashima K.,Kimura T.,Kishida Y.,Kohara M.,Matsumoto M.,Matsuno A.,Muraki A.,Nakazaki N.,Shimpo S.,Sugimoto M.,Takazawa M.,Yamada M.,Yasuda M.,Tabata S.
Complete genomic sequence of the filamentous nitrogen-fixing cyanobacterium Anabaena sp. strain PCC 7120.
DNA Res.
8
205-213
2001
1208966
Srivastava A.K.,Alexova R.,Jeon Y.J.,Kohli G.S.,Neilan B.A.
Assessment of salinity-induced photorespiratory glycolate metabolism in Anabaena sp. PCC 7120.
Microbiology
157
911-917
2011
1208967
Hackenberg C.,Kern R.,Huge J.,Stal L.J.,Tsuji Y.,Kopka J.,Shiraiwa Y.,Bauwe H.,Hagemann M.
Cyanobacterial lactate oxidases serve as essential partners in N2 fixation and evolved into photorespiratory glycolate oxidases in plants.
Plant Cell
23
2978-2990
2011