Sequence of I2CM37_SOLHA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
7-epizingiberene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing]
I2CM37
Solanum habrochaites
777
90727
Reaction
(2Z,6Z)-farnesyl diphosphate = 7-epizingiberene + diphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>I2CM37|7-epizingiberene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing]|EC 4.2.3.142|Solanum habrochaites|TrEMBL
MIVGYRSTIITLSHPKLGNGKTISSNAIFRRSCRVRCSHSTPSSMNGFEDARDRIRESFG
KVELSPSSYDTAWVAMVPSKHSLNEPCFPQCLDWIIENQREDGSWGLNPSHPLLLKDSLS
STLACLLALTKWRVGDEQIKRGLGFIETQSWAIDNKDQISPLGFEIIFPSMIKSAEKLNL
NLAINKRDSTIKRALQNEFTRNIEYMSEGFGELCDWKEIIKLHQRQNGSLFDSPATTAAA
LIYHQHDKKCYEYLNSILQQHKNWVPTMYPTKIHSLLCLVDTLQNLGVHRHFKSEIKKAL
DEIYRLWQQKNEEIFSNVTHCAMAFRLLRISYYDVSSDELAEFVDEEHFFATSGKYTSHV
EILELHKASQLAIDHEKDDILDKINNWTRTFMEQKLLNNGFIDRMSKKEVELALRNFYII
SDLAENRRYIKSYEENNFKILKAAYRSPNINNKDLFIFSIRDFELCQAQHQEELQQLKRW
FEDCRLDQLGLSEQFISASYLCAIPIVPGPELSDARLVYAKYVMLLTIVDDHFESFASTD
ECLNIIELVERWDDYASVGYKSERVKVLFSMFYKSIEEIATIAEIKQGRSVKNHLINLWL
KVMKLMLMERVEWCSGKTIPRIEEYLYVSSITFGSRLIPLTTQYFIGIKISKDLLESDEI
YGLCNFTGIVLRLLNDLQDSKREQKEGSINLVTLLMKSISEEEAIMKMKEILEMKRRELF
KMVLVQKKGSQLPQLCKEIFWRTCKWAHFTYSQTDRYRFPEEMENHIDEVFYKPLNH
Download this sequence
in fasta format
Download all sequences for 4.2.3.142
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
43549285
Gonzales-Vigil E.,Hufnagel D.E.,Kim J.,Last R.L.,Barry C.S.
Evolution of TPS20-related terpene synthases influences chemical diversity in the glandular trichomes of the wild tomato relative Solanum habrochaites.
Plant J.
71
921-935
2012
43549286
Matsuba Y.,Nguyen T.T.,Wiegert K.,Falara V.,Gonzales-Vigil E.,Leong B.,Schafer P.,Kudrna D.,Wing R.A.,Bolger A.M.,Usadel B.,Tissier A.,Fernie A.R.,Barry C.S.,Pichersky E.
Evolution of a complex locus for terpene biosynthesis in Solanum.
Plant Cell
25
2022-2036
2013