Sequence of SAFD_NEPCE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
sulfoacetaldehyde dehydrogenase
Q2BN77
Neptuniibacter caesariensis
456
49258
Reaction
2-sulfoacetaldehyde + H2O + NAD+ = sulfoacetate + NADH + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q2BN77|sulfoacetaldehyde dehydrogenase|EC 1.2.1.73|Neptuniibacter caesariensis|Swiss-Prot
MSNTYSLVNPFDNSPLGEYEYTPWATLENQLAMLKEGQLSQRKTAAFQRAGVLNKLAALL
KEHSEEMATLITQETGKTILDSRVEMMRAYNAAIASAEEARQIQGESLDSDAYAPAGGKI
GVVCWKPLGTILCITPFNFPINIAIHKIGPAYAAGNTILFKPGPQNTASAQLLVKLCYEA
GMPENTLQLCMPEFSDLDRLNAHPDVNAINFTGGTAAANAISAAAGYKKLLLELGGNDPL
IVMDDGDLEAATTAAINHRFATAGQRCTAAKRLFIHANVYEAFRDLLVEKSSKLVVGDPM
KDDTFVGPVINQGAADQIRTLIEQAIEDGASVALGNQYEGAFVYPTILENVSPTSEIMVE
EAFGPVMPLYKFESVEEIIPIINNTAYGLQAGVFSQNLATIKELYEQLDVGTLAANDGPG
FRTEHFPFGGVKESGIGREGIKYAIREMSYTKTLVI
Download this sequence
in fasta format
Download all sequences for 1.2.1.73
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
97965
Krejcik Z.,Denger K.,Weinitschke S.,Hollemeyer K.,Paces V.,Cook A.M.,Smits T.H.
Sulfoacetate released during the assimilation of taurine-nitrogen by Neptuniibacter caesariensis: purification of sulfoacetaldehyde dehydrogenase.
Arch. Microbiol.
190
159-168
2008