Sequence of SCPB_TRIRU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
carboxypeptidase D
Q5J6J2
Trichophyton rubrum
662
73012
Reaction
preferential release of a C-terminal arginine or lysine residue
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5J6J2|carboxypeptidase D|EC 3.4.16.6|Trichophyton rubrum|Swiss-Prot
MVSFCGVAACLLTVAGHLAQAQFPPKPEGVTVLESKFGSGARITYKEPGLCETTEGVKSY
AGYVHLPPGTLRDFGVEQDYPINTFFWFFEARKDPENAPLGIWMNGGPGSSSMFGMMTEN
GPCFVNADSNSTRLNPHSWNNEVNMLYIDQPVQVGLSYDTLANFTRNLVTDEITKLKPGE
PIPEQNATFLVGTYASRNMNTTAHGTRHAAMALWHFAQVWFQEFPGYHPRNNKISIATES
YGGRYGPAFTAFFEEQNQKIKNGTWKGHEGTMHVLHLDTLMIVNGCIDRLVQWPAYPQMA
YNNTYSIEAVNASIHAGMLDALYRDGGCRDKINHCRSLSSVFDPENLGINSTVNDVCKDA
ETFCSNDVRDPYLKFSGRNYYDIGQLDPSPFPAPFYMAWLNQPHVQAALGVPLNWTQSND
VVSTAFRAIGDYPRPGWLENLAYLLENGIKVSLVYGDRDYACNWFGGELSSLGINYTDTH
EFHNAGYAGIQINSSYIGGQVRQYGNLSFARVYEAGHEVPSYQPETALQIFHRSLFNKDI
ATGTKDTSSRMDGGKFYGTSGPADSFGFKNKPPPQHVHFCHILDTSTCTKEQIQSVENGT
AAVRSWIIVDSNSTSLFPEVVGSGEPTPTPMPGGATTLSAHGFLYGVTLWAVIVVAVIEL
AM
Download this sequence
in fasta format
Download all sequences for 3.4.16.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
94838
Zaugg C.,Jousson O.,Lechenne B.,Staib P.,Monod M.
Trichophyton rubrum secreted and membrane-associated carboxypeptidases.
Int. J. Med. Microbiol.
298
669-682
2008
94839
Zaugg C.,Monod M.,Weber J.,Harshman K.,Pradervand S.,Thomas J.,Bueno M.,Giddey K.,Staib P.
Gene expression profiling in the human pathogenic dermatophyte Trichophyton rubrum during growth on proteins.
Eukaryot. Cell
8
241-250
2009