Sequence of DCIP_AZOBR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
indolepyruvate decarboxylase
P51852
Azospirillum brasilense
545
57981
Reaction
3-(indol-3-yl)pyruvate = 2-(indol-3-yl)acetaldehyde + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>P51852|indolepyruvate decarboxylase|EC 4.1.1.74|Azospirillum brasilense|Swiss-Prot
MKLAEALLRALKDRGAQAMFGIPGDFALPFFKVAEETQILPLHTLSHEPAVGFAADAAAR
YSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGNAGLLLHHQGRTLDT
QFQVFKEITVAQARLDDPAKAPAEIARVLGAARALSRPVYLEIPRNMVNAEVEPVGDDPA
WPVDRDALAACADEVLAAMRSATSPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGR
GLLADAPTPPLGTYIGVAGDAEITRLVEESDGLFLLGAILSDTNFAVSQRKIDLRKTIHA
FDRAVTLGYHTYADIPLAGLVDALLEGLPPSDRTTRGKEPHAYPTGLQADGEPIAPMDIA
RAVNDRVRAGQEPLLIAADMGDCLFTAMDMIDAGLMAPGYYAGMGFGVPAGIGAQCVSGG
KRILTVVGDGAFQMTGWELGNCRRLGIDPIVILFNNASWEMLRTFQPESAFNDLDDWRFA
DMAAGMGGDGVRVRTRAELKAALDKAFATRGRFQLIEAMIPRGVLSDTLARFVQGQKRLH
AAPRE
Download this sequence
in fasta format
Download all sequences for 4.1.1.74
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
1028178
Costacurta A.,Keijers V.,Vanderleyden J.
Molecular cloning and sequence analysis of an Azospirillum brasilense indole-3-pyruvate decarboxylase gene.
Mol. Gen. Genet.
243
463-472
1994