Sequence of TDH_ECOLI

EC Number:1.1.1.103

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-threonine 3-dehydrogenase
P07913
Escherichia coli (strain K12)
341
37239
Reaction
L-threonine + NAD+ = L-2-amino-3-oxobutanoate + NADH + H+
Other sequences found for EC No. 1.1.1.103

General information:

Sequence
show sequence in normal format
>|L-threonine 3-dehydrogenase|EC 1.1.1.103||
MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD
Download this sequence
in fasta format
Download all sequences for 1.1.1.103
in fasta format
in csv (Excel, OpenOffice) format