Sequence of G0QVX6_ICHMG

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
calpain-3
G0QVX6
Ichthyophthirius multifiliis (strain G5)
465
53950
Reaction
broad endopeptidase activity
Sequences with same EC No.
Sequence
show sequence in normal format
>G0QVX6|calpain-3|EC 3.4.22.54|Ichthyophthirius multifiliis (strain G5)|TrEMBL
MDQDILVKKQWFIKSMNGKIDDYYDMKNKKQLGSGQFGSVIEVNQKGSDLRRAVKIIKKS
SIENQQMFQNEINIMRELDHPNIIRLYEIYEDQRKIYLVMELCQGGELFDLITTRQKFTE
QEARIIFKQVALALSYCHSHGICHRDLKPENLLLYIKDDITSIKVADFGLSCIFKSKNQQ
EKKQLQGRAGSAYYMSPEVLSGQYNELCDSWSLGVILYILLSGIPPFYGNTDQKIFERIQ
KKQYSFQFKQFDNVSKEVIDLINQCFQDQNQRPSVKQILDHSWINKDLENLKDFNLNQFK
IFAGTTKLKKIALNFIASRLSESEIKDLGNLFKQLDKNNDGVLSVSEISNAIKIFSGKQE
QITDLLKQIDTDQNGTIEYTEFVAASIQRQLFLKQEKLYYAFQALDIDGSGSISKQELQK
ILNEEGNSLNYTEDYWTQLIDGADKDKNGEIDYNEFVEMMGEIYI
Download this sequence
in fasta format
Download all sequences for 3.4.22.54
in fasta format
in csv (Excel, OpenOffice) format