Sequence of A0A371QDJ7_9STRE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
6-phospho-beta-glucosidase
A0A371QDJ7
Streptococcus sp. NM
479
54835
Reaction
6-phospho-beta-D-glucosyl-(1->4)-D-glucose + H2O = D-glucose + D-glucose 6-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A371QDJ7|6-phospho-beta-glucosidase|EC 3.2.1.86|Streptococcus sp. NM|TrEMBL
MTEKLTFPDGFLWGGATAANQCEGAYNLEGRGLANVDVVPIGPDREAIITGQKKIFSFEE
GYFYPAKEAIDMYHHYKEDIALFAEMGFKTYRLSIAWTRIFPKGDEIEPNEAGLAFYEDL
FKECHKYGIQPLVTITHFDCPMHLITEYGGWRNRRMLDFYEKLCRTLFTRYKGLVKYWLT
FNEINMILHAPFMGAGLCFEEGENQELVKYQAAHHELVASALATKIAHEIDPENKVGCML
AAGQYYPNTAHPRDYWAAMEEDRKSYFFIDVQACGEYPNYAKKQWERERIEIQMTAEDLE
LLKDNTVDFVSFSYYASLVASGDPEVKELTAGNIFASLKNPYLESSEWGWQIDPLGLRIT
LNAIWDRYQKPMFIVENGLGAMDTPDENGHVADDYRIAYLEAHIKAMRDAIYQDGVDLLG
YTTWGCIDLVSAGTGEMNKRYGFIYVDRDNAGHGSLKRSKKKSFYWYKDVIASNGASIE
Download this sequence
in fasta format
Download all sequences for 3.2.1.86
in fasta format
in csv (Excel, OpenOffice) format