Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of RHAM_BACSU

EC Number:5.1.3.32

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-rhamnose mutarotase
O05263
Bacillus subtilis (strain 168)
104
12575
Reaction
alpha-L-rhamnopyranose = beta-L-rhamnopyranose
Other sequences found for EC No. 5.1.3.32

General information:

Sequence
show sequence in normal format
>|L-rhamnose mutarotase|EC 5.1.3.32||
MKRKASIMFVHQDKYEEYKQRHDDIWPEMAEALKAHGAHHYSIFLDEETGRLFAYLEIED
EEKWRKMADTEVCQRWWKSMAPLMKTNSDFSPVAIDLKEVFYLD
Download this sequence
in fasta format
Download all sequences for 5.1.3.32
in fasta format
in csv (Excel, OpenOffice) format