Sequence of AL9A1_PONAB

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
4-trimethylammoniobutyraldehyde dehydrogenase
Q5R8A4
Pongo abelii
494
53787
Reaction
4-trimethylammoniobutanal + NAD+ + H2O = 4-trimethylammoniobutanoate + NADH + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5R8A4|4-trimethylammoniobutyraldehyde dehydrogenase|EC 1.2.1.47|Pongo abelii|Swiss-Prot
MSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPATGRVIATFTCSGEKEVNLAVQNAKA
AFKIWSQKSGMERCRILLEAARIIREREGEIATMECINNGKSIFEARLDINISWQCLEYY
AGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQITSWKSAPALACGNAMVFK
PSPFTPVSALLLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKI
MEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI
LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIY
VPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLA
AGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQL
KTVCVEMGDVESAF
Download this sequence
in fasta format
Download all sequences for 1.2.1.47
in fasta format
in csv (Excel, OpenOffice) format