Sequence of A0A2P6QF80_ROSCH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
phytochromobilin:ferredoxin oxidoreductase
A0A2P6QF80
Rosa chinensis
336
38807
Reaction
(3Z)-phytochromobilin + 2 oxidized ferredoxin = biliverdin IXalpha + 2 reduced ferredoxin
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2P6QF80|phytochromobilin:ferredoxin oxidoreductase|EC 1.3.7.4|Rosa chinensis|TrEMBL
MECSSSSSSSSSSSLSSFSILRKPCPFVPPFTAVYRKQQQQRRPLIQLSAVSYNKFIHFA
LDESKRRTHLAPSPLQERYNSMVSMDGNAELQMSSFKATKIRLLRSLCIETRTMQVLDFA
VFPEPEFDMPIFCANFFTSADVNIVVLDLNPLHNVIIEREYRDKYYKGLIPLGVKYAELL
PWGGKLTSESLKFFSPIVIWTRFTSSPEKYEVLYSAFMDYYKAWLELMDQAVVETNASQI
KRNREAQHRYLTWRAEKDPGHGVLKRLIGETQAKDLLVNFLFNGIDKLGSKSFLEYFPEY
CCEDGTINHKRSIIGKSYESRPWDRKGEFVSSNFES
Download this sequence
in fasta format
Download all sequences for 1.3.7.4
in fasta format
in csv (Excel, OpenOffice) format