Sequence of CAN3_SHEEP

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
calpain-3
Q9TTH8
Ovis aries
822
94595
Reaction
broad endopeptidase activity
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9TTH8|calpain-3|EC 3.4.22.54|Ovis aries|Swiss-Prot
MPTVISASVAPRTGAEPRSPGPIAQAAQGKGTEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHRKCLEKKVLFVDPEFPPDETSLFYSQKFPIQFIWKRPPEICENPRFIIGGANRTD
ICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKAGNTTEGMEDFTGELTEFFE
IKDAPRDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLKMGELIERMVRNMDNSRLR
DSDLIPEGCSDDRPTRTIVPVQYETRMACGLVKGHAYSVTGLEEALYKGEKVKLVRLRNP
WGQVEWNGSWSDSWKDWSYVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTAD
ALESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICS
FLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYIN
MREVSERFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKP
KPIIFGSDRANSNKELGVDQESEEGKDNTSPDKQAKSPQLKPGNIDQESKEQRQFRNIFR
QIAGDDMEICADELKNVLNRVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHH
LWKKIKTWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKYMNIDF
DSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA
Download this sequence
in fasta format
Download all sequences for 3.4.22.54
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
868417
Nonneman D.,Koohmaraie M.
Molecular cloning and mapping of the bovine and ovine skeletal muscle-specific calpains.
Anim. Genet.
30
456-458
1999
868418
Ilian M.A.,Morton J.D.,Kent M.P.,Le Couteur C.E.,Hickford J.,Cowley R.,Bickerstaffe R.
Intermuscular variation in tenderness: association with the ubiquitous and muscle-specific calpains.
J. Anim. Sci.
79
122-132
2001