Sequence of PHNC_STAAS

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ABC-type phosphonate transporter
Q6GCY2
Staphylococcus aureus (strain MSSA476)
257
28689
Reaction
ATP + H2O + phosphonate-[phosphonate-binding protein][side 1] = ADP + phosphate + phosphonate[side 2] + [phosphonate-binding protein][side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q6GCY2|ABC-type phosphonate transporter|EC 7.3.2.2|Staphylococcus aureus (strain MSSA476)|Swiss-Prot
MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
SEIYGRTIKEDEKLGVN
Download this sequence
in fasta format
Download all sequences for 7.3.2.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
76508
Holden M.T.G.,Feil E.J.,Lindsay J.A.,Peacock S.J.,Day N.P.J.,Enright M.C.,Foster T.J.,Moore C.E.,Hurst L.,Atkin R.,Barron A.,Bason N.,Bentley S.D.,Chillingworth C.,Chillingworth T.,Churcher C.,Clark L.,Corton C.,Cronin A.,Doggett J.,Dowd L.,Feltwell T.,Hance Z.,Harris B.,Hauser H.,Holroyd S.,Jagels K.,James K.D.,Lennard N.,Line A.,Mayes R.,Moule S.,Mungall K.,Ormond D.,Quail M.A.,Rabbinowitsch E.,Rutherford K.M.,Sanders M.,Sharp S.,Simmonds M.,Stevens K.,Whitehead S.,Barrell B.G.,Spratt B.G.,Parkhill J.
Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance.
Proc. Natl. Acad. Sci. U.S.A.
101
9786-9791
2004