Sequence of A0A2H6IWF9_9BACT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L(+)-tartrate dehydratase
A0A2H6IWF9
bacterium BMS3Bbin10
330
35889
Reaction
(R,R)-Tartrate = oxaloacetate + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2H6IWF9|L(+)-tartrate dehydratase|EC 4.2.1.32|bacterium BMS3Bbin10|TrEMBL
MKDQEQGKMIRADAIEQAANRIMSNAAIDIPEDYLSGIRAMIDTEKGDLSAFVLEAMLEN
WQAASEDRRPMCADSGLPRYYVKSGNEARLEGGFVELEHRLRRATAQATHDIPLRPNRVH
PITRQDNNNNVGMNAPEIEYSFEPDADWIDITTVHKGGLFGSDYRMLFPGDGIDGIKRFF
LDVLLAFGKRGLACQPAIVGVGLGGSKDTCMMLGKQAACLRTVGSNHPQAEVAKLEGELQ
ELGNRTGLGAMGFKGTSTVVGCNIEVGYTHTGGMPMSVHCFCLSSRRATARLHGDGSVEY
RTDPQWFTPYMRRNSVGWDGGAGAVAGAAE
Download this sequence
in fasta format
Download all sequences for 4.2.1.32
in fasta format
in csv (Excel, OpenOffice) format