Sequence of PDXK_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
pyridoxal kinase
O35331
Rattus norvegicus
312
34908
Reaction
ATP + pyridoxal = ADP + pyridoxal 5'-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>O35331|pyridoxal kinase|EC 2.7.1.35|Rattus norvegicus|Swiss-Prot
MEGECRVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLTSQ
ELHALYEGLKANNVNKYDYVLTGYTRDKSFLGMVVDIVQELKQQNSRLVYVCDPVMGDKW
NGEGSMYVPQDLLPVYREKVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMGP
DTVVITSSDLPSPKGSDYLMALGSQRMRKPDGSTVTQRIRMEMRKVDPVFVGTGDLFAAM
LLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSRKDI
EDPEIVVQATVL
Download this sequence
in fasta format
Download all sequences for 2.7.1.35
in fasta format
in csv (Excel, OpenOffice) format