Sequence of PDE4_CAEEL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3',5'-cyclic-nucleotide phosphodiesterase
Q22000
Caenorhabditis elegans
674
75389
Reaction
nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q22000|3',5'-cyclic-nucleotide phosphodiesterase|EC 3.1.4.17|Caenorhabditis elegans|Swiss-Prot
MPRRRGSSSSSSAAGGSGGGGGFGFSSLRRELHLHNFFRTSSPSASSTSRTPPAALPPRT
SAVTIPGSNHKLTSSASSYHPPRELTVSTFSAGSATAADGLGGAHLTPSLSSSVHARRES
FLYRASDDLREASSLRPVSRASSIASNEHGHGDDLIVTPFAQLLASLRNVRSNLISITNI
QNSDDSRHANRSAKRPPLHNIELPDDVVHCAHDTLEELDWCLDQLETIQTHRSVSEMASS
KFRKMLNKELSHFAESSKSGTQVSKFLITTYMDKEEDEPSIEIEVPTEVQGPSTSGPMTL
SILKKAQTAAMNKISGVRKLRAPSHDGHVPEYGVNCAREIAVHMQRLDDWGPDVFKIDEL
SKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMH
VLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHH
LAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVA
GNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLE
ISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWYQSRIPEE
PDTARTVTEDDEHK
Download this sequence
in fasta format
Download all sequences for 3.1.4.17
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
74673
Genome sequence of the nematode C. elegans: a platform for investigating biology.
Science
282
2012-2018
1998
74674
Yu B.,Wang X.,Wei S.,Fu T.,Dzakah E.E.,Waqas A.,Walthall W.W.,Shan G.
Convergent Transcriptional Programs Regulate cAMP Levels in C. elegans GABAergic Motor Neurons.
Dev. Cell
43
212-226
2017