Sequence of A0A4R6DA37_HAEHA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
biotin-[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
A0A4R6DA37
Haemophilus haemolyticus
301
34041
Reaction
ATP + biotin + apo-[propionyl-CoA:carbon-dioxide ligase (ADP-forming)] = AMP + diphosphate + [propionyl-CoA:carbon-dioxide ligase (ADP-forming)]
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A4R6DA37|biotin-[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase|EC 6.3.4.10|Haemophilus haemolyticus|TrEMBL
MNFALLTYLSDCQPKVRFELEKFSPDIEEDIKQLRELGLEIVVDDQNYCLVPNLPLLNPK
QISTALFPYSTHYQPIISSTNEWILQNIPSLKKGDLCVAEYQTSGRGRRGRQWLSPFAGQ
IMFSFYWAFDPKKSIEGLSLVIGLAIAEVLNVQVKWPNDILFDGRKLGGILVEIANHKNG
MFNLVIGVGINVSLPKQTQISQPYAEVCEIDPDVERQTLLPKLIQHLYARLTIFEKNGIN
AEFQQAWQSYNAFSNNEVNVLTEQGAISGIEQGIDERGYLKVLCGNKIQMFNGGEVSLRK
K
Download this sequence
in fasta format
Download all sequences for 6.3.4.10
in fasta format
in csv (Excel, OpenOffice) format