Sequence of Q2UVB3_MAIZE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycoprotein 2-beta-D-xylosyltransferase
Q2UVB3
Zea mays
512
56606
Reaction
UDP-alpha-D-xylose + N4-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc]-L-asparaginyl-[protein] = UDP + N4-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-[beta-D-Xyl-(1->2)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc]-L-asparaginyl-[protein]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q2UVB3|glycoprotein 2-beta-D-xylosyltransferase|EC 2.4.2.38|Zea mays|TrEMBL
MMAGRAHGHRNRLRRLIPRLLLLLVAVYAASFAIYLLLQSHSHHQSPPDPTPRTEARDGV
LAPSSSQKPWPRLPSFLPWVSSAVPPPPLHTCEAYFGNGFSRRVDVLPAGRGSGGGGWFR
CHHSETLGSSICEGARVRLDPALIAMSRGGEPLEQVMGRAEEEELPKYEPGALQVEGPAA
GMPVPLVDAGFLNDYVPTGGIGMHTMRALLESTRVVPPVHCSQWVEEPTLPVTRFEYASL
FHTITDWYSAYVSSRVTNLPDRPNVVFVDGHCKAQLEETWEALFSSVTYAKNFTVPVCFR
HAILSPLGYETAMFKGLSESFSCEGASVDSLREKPDYEKTARLSEFGEMIVASFDLLQDD
IMSSKKSNGLNVLFVRREDYLAHPRHSGKVESRLSNEQEVYDAIDKWAQGLKCKVNVANG
LFAHMTMKEQLRAILEASVVIGAHGAGLTHLVSATPDTKVLEIISSMYRRPHFALISHWK
SLEYHAINLPGSFARVTDVINELRKILEGLGC
Download this sequence
in fasta format
Download all sequences for 2.4.2.38
in fasta format
in csv (Excel, OpenOffice) format