Sequence of BTUD_ECO5E

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ABC-type vitamin B12 transporter
B5YPZ7
Escherichia coli O157:H7 (strain EC4115 / EHEC)
249
27097
Reaction
ATP + H2O + vitamin B12-[cobalamin-binding protein][side 1] = ADP + phosphate + vitamin B12[side 2] + [cobalamin-binding protein][side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>B5YPZ7|ABC-type vitamin B12 transporter|EC 7.6.2.8|Escherichia coli O157:H7 (strain EC4115 / EHEC)|Swiss-Prot
MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAG
QPLEAWSATKLALHRAYLSQQQTPPFAMPVWHYLTLHQHDKTRTELLNDVAGALALDDKL
GRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALC
QQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREDVLTPPNLAQAYGMNFRRLDIE
GHRMLISTI
Download this sequence
in fasta format
Download all sequences for 7.6.2.8
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
751202
Eppinger M.,Mammel M.K.,Leclerc J.E.,Ravel J.,Cebula T.A.
Genomic anatomy of Escherichia coli O157:H7 outbreaks.
Proc. Natl. Acad. Sci. U.S.A.
108
20142-20147
2011