Sequence of U2ERD1_9GAMM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
acylglycerol kinase
U2ERD1
Salinisphaera shabanensis E1L3A
343
37413
Reaction
ATP + acylglycerol = ADP + acyl-sn-glycerol 3-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>U2ERD1|acylglycerol kinase|EC 2.7.1.94|Salinisphaera shabanensis E1L3A|TrEMBL
MDFHPILAENALWRQHAYFVDCACHGAHLRCWLCYFQSVKILRALLLINQKSRQGEANAQ
AARDALEALDVEITLGKFEEPDDVPAEIDRHAPNVDIIVLGGGDGTLNLAAAAVMRAGRP
MGVLPLGTANDFARTLLIPTELEAACRNVVEGVSHGVDLGQCNDVYFVNVASVGLAVRAC
EYRSDAAKKWFGSFGYASNVFKAYRDTEPFDAVVRCGDETHRLHSIQLAIGNGRYFGGGL
AVASDAALDDGRLDLYSLQPQSLTKLMGMIPTLVRGPDKSIQGVQLLEGTEFEVDTGKPM
PINTDGEILTETPATFRIHPGALQVKVPQEYVDRYGRDNKNNQ
Download this sequence
in fasta format
Download all sequences for 2.7.1.94
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
136313271
Antunes A.,Alam I.,Bajic V.B.,Stingl U.
Genome sequence of Salinisphaera shabanensis, a gammaproteobacterium from the harsh, variable environment of the brine-seawater interface of the Shaban Deep in the Red Sea.
J. Bacteriol.
193
4555-4556
2011
136313272
Alam I.,Antunes A.,Kamau A.A.,Ba Alawi W.,Kalkatawi M.,Stingl U.,Bajic V.B.
INDIGO - INtegrated Data Warehouse of MIcrobial GenOmes with Examples from the Red Sea Extremophiles.
PLoS ONE
8
0-0
2013