Sequence of Q1Q6L6_KUEST

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
hydroxylamine oxidase
Q1Q6L6
Kuenenia stuttgartiensis
852
96352
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>Q1Q6L6|hydroxylamine oxidase|EC 1.7.3.4|Kuenenia stuttgartiensis|TrEMBL
MLNKSAALVPVVLAFLFLFLCFQCLYADIRCLTGKDGAVHLEMEAKPLTIEPRPGVFFDA
WGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLTVPASIHPHGVKYTTANVGVNIAGNPA
SIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGGEEGLSRGLWGALIVEPVGGDPNPPDKE
FVVFMHAFNVNGQEYYAFNNKSGDIELMRGDSSAFPGETWKAKMGDKVRFHLINITEEAH
TFHTHGHRWLDKSCDKLIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFG
IFMVEEGKRVNAVIASCDEGRKTLSAPGQDRQPPTLEGFSGAYMYPEITEKNMYESFAGL
EKGDGIWGDYYSPIPLYTYFNPSRHYVPPESDAYTNLLVKYRPDQCVECHEETTPGIVAE
WKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGTKDGVYCSYCHGSDHEKLFMPTVD
NSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQNM
SSCDDCHSRHRFSAAEARRPEACSICHMGPDHPDWESYSRSKWGVIYETTKERWNWDKNL
AEVIPGEDYLAPTCQYCHMYVGNNKWEMNVETKGIWRMGVIPPKEVEFKSGLKDFPYGIK
IPPMDKKLEIYSAESQEKRRKWVELCSKCHSSRFAGMWLDSLDQYMFESWRRIDEAQLII
EKLFSENAIEPPPEKRPPFPLSDLIIKVLGAEKLGAEMYRLFKQTNGHLPVIGPILGAYS
IFTQNEGNPGGIEREYAEMWFWSHLQGYKGAAHAQPDISWWWGTAQGVGNLTRIRDEAEK
LRRLKSGSSSGF
Download this sequence
in fasta format
Download all sequences for 1.7.3.4
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
167510180
Strous M.,Pelletier E.,Mangenot S.,Rattei T.,Lehner A.,Taylor M.W.,Horn M.,Daims H.,Bartol-Mavel D.,Wincker P.,Barbe V.,Fonknechten N.,Vallenet D.,Segurens B.,Schenowitz-Truong C.,Medigue C.,Collingro A.,Snel B.,Dutilh B.E.,OpDenCamp H.J.M.,vanDerDrift C.,Cirpus I.,vanDePas-Schoonen K.T.,Harhangi H.R.,vanNiftrik L.,Schmid M.,Keltjens J.,vanDeVossenberg J.,Kartal B.,Meier H.,Frishman D.,Huynen M.A.,Mewes H.,Weissenbach J.,Jetten M.S.M.,Wagner M.,LePaslier D.
Deciphering the evolution and metabolism of an anammox bacterium from a community genome.
Nature
440
790-794
2006
167510298
Strous M.,Pelletier E.,Mangenot S.,Rattei T.,Lehner A.,Taylor M.W.,Horn M.,Daims H.,Bartol-Mavel D.,Wincker P.,Barbe V.,Fonknechten N.,Vallenet D.,Segurens B.,Schenowitz-Truong C.,Medigue C.,Collingro A.,Snel B.,Dutilh B.E.,OpDenCamp H.J.M.,vanDerDrift C.,Cirpus I.,vanDePas-Schoonen K.T.,Harhangi H.R.,vanNiftrik L.,Schmid M.,Keltjens J.,vanDeVossenberg J.,Kartal B.,Meier H.,Frishman D.,Huynen M.A.,Mewes H.,Weissenbach J.,Jetten M.S.M.,Wagner M.,LePaslier D.
Deciphering the evolution and metabolism of an anammox bacterium from a community genome.
Nature
440
790-794
2006