Sequence of A0A1G9SRI9_9PSED

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NAD(P)H dehydrogenase (quinone)
A0A1G9SRI9
Pseudomonas balearica DSM 6083
199
20925
Reaction
NAD(P)H + H+ + a quinone = NAD(P)+ + a hydroquinone
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1G9SRI9|NAD(P)H dehydrogenase (quinone)|EC 1.6.5.2|Pseudomonas balearica DSM 6083|TrEMBL
MAKILVLYHSMYGHIETMANAVAEGARGVSDAEVTIKRVPETMPEEAFEKAGGKVDQAAP
VASPAELADYDAIIFGTPTRFGNMSGQMRNFLDQTGGLWAQGKLHGKVASVFTSTGTGGG
QEMTITSTWTTLAHHGMILVPTGYGIPEFADISEVNGGTPYGASTIAGGDGSRQPSEKEL
TMARYQGELVAKVAQKLKG
Download this sequence
in fasta format
Download all sequences for 1.6.5.2
in fasta format
in csv (Excel, OpenOffice) format