Sequence of A0A1D0CAI9_9FABA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
photosystem I
A0A1D0CAI9
Acacia tysonii
81
9038
Reaction
reduced plastocyanin + oxidized ferredoxin + hnu = oxidized plastocyanin + reduced ferredoxin
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1D0CAI9|photosystem I|EC 1.97.1.12|Acacia tysonii|TrEMBL
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVRVYLWHETTRSMGLAY
Download this sequence
in fasta format
Download all sequences for 1.97.1.12
in fasta format
in csv (Excel, OpenOffice) format