Sequence of TRMN_THET2

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
Q72IH5
Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
335
36980
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>Q72IH5||EC 2.1.1|Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)|Swiss-Prot
MWLEATTHPGLEDLLLEELSALYPGEGAEVDARKGRVRIPRAWVGEEALGLRLAHHLVLF
RARLLLSREDPLGALERAALALPWPELEGAGSFRVEARREGEHPFTSPEVERRVGEALHR
AYGVPVDLKRPAVRVRVDVRGEEAFLGVQLTERPLSRRFPKAALRGSLTPVLAQALLRLA
DARPGMRVLDPFTGSGTIALEAASTLGPTSPVYAGDLDEKRLGLAREAALASGLSWIRFL
RADARHLPRFFPEVDRILANPPHGLRLGRKEGLFHLYWDFLRGALALLPPGGRVALLTLR
PALLKRALPPGFALRHARVVEQGGVYPRVFVLEKL
Download this sequence
in fasta format
Download all sequences for 2.1.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
591754
Henne A.,Brueggemann H.,Raasch C.,Wiezer A.,Hartsch T.,Liesegang H.,Johann A.,Lienard T.,Gohl O.,Martinez-Arias R.,Jacobi C.,Starkuviene V.,Schlenczeck S.,Dencker S.,Huber R.,Klenk H.-P.,Kramer W.,Merkl R.,Gottschalk G.,Fritz H.-J.
The genome sequence of the extreme thermophile Thermus thermophilus.
Nat. Biotechnol.
22
547-553
2004
591755
Fislage M.,Roovers M.,Muennich S.,Droogmans L.,Versees W.
Crystallization and preliminary X-ray crystallographic analysis of putative tRNA-modification enzymes from Pyrococcus furiosus and Thermus thermophilus.
Acta Crystallogr. F
67
1432-1435
2011
591756
Roovers M.,Oudjama Y.,Fislage M.,Bujnicki J.M.,Versees W.,Droogmans L.
The open reading frame TTC1157 of Thermus thermophilus HB27 encodes the methyltransferase forming N2-methylguanosine at position 6 in tRNA.
RNA
18
815-824
2012
591757
Fislage M.,Roovers M.,Tuszynska I.,Bujnicki J.M.,Droogmans L.,Versees W.
Crystal structures of the tRNA:m2G6 methyltransferase Trm14/TrmN from two domains of life.
Nucleic Acids Res.
40
5149-5161
2012