Sequence of FAN1_AILME

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
phosphodiesterase I
D2HNY3
Ailuropoda melanoleuca
1025
114770
Reaction
hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides
Sequences with same EC No.
Sequence
show sequence in normal format
>D2HNY3|phosphodiesterase I|EC 3.1.4.1|Ailuropoda melanoleuca|Swiss-Prot
MSEGKSPAKKRARRSLSISKTKKNECNSIISFFNNVPPAKLACPICSKMVPRYDLNWHLD
EKCANNDNITPVDLRHVGFTDSSGSTVNLTNTVLENVTPGKLSPSKASLTPDPSDSAKMG
IKQQTSPYFKNNKDLVFKNQDKLRHHNVKVITLGSLSSKLSRRYTEARRSICKKNEEFAS
KSPQSPSSTVVRSPVDNCSEIEDKDQILENSSQKENVFTCDSLNEQRTEHSVEDTKVLEA
ESQEATQECGRSPLTPAFSDNAFVLFSPDLTRGNPLRSTSEDSLEWETITGIDGKDVEKC
EAGSCEEVKVTVASEAKTQLSDWEAKCHSSTPDDSKGCNIQDLLLEGDSDLKNEITCRIP
LEQGSSCDVPDKTVTVPPSHPYYLRSFLVVLKAVFENEEDRMLFDEHEKEIVTKFYQLSA
SAQKLYVRLFQRKFSWLKMNKLEYEEIAPDLTPVIGELQQAGFLQTESELQELSEVLELL
SAPELKTLAKTFHLVNPNGQKQQLVDTFLKLAKQPSVCTWGKNQPGIGAVILKRAKGLAG
QALRVCKGPRAVFSRVLLLFSLTDSLEDEEAACGGQGQLSTVLLVNLGRMEFPRYTINRK
TQIFQDRDDLIRYAAAAHMLSDISTAMANGNWKEANELSQCAKSDWNKLKSHPSLRYHEN
LPLFLRCFTVGWIYTRILSRTVEILQRLHMYEEAVKELESLLSQRVYCPDSRGRWWDRLA
LNLHQHLKRLEPAIKCITEGLADPEVRTGHRLSLYQRALRLRESPSCQKYRHLFHQLPEV
TVGDVKHVTITGRLCPQRGMGKSVFVMEAGGPTAPATVLCSVEEVALAYYRRSGFDQGIH
GEGSTFSTLYGLLLWDIIFMDGIPDVFRNAYQASPLDLCTDSFFASRGPAIEARLQRIHS
APAESLRAWVAAAWQAQEGRVASIVSWDRFASLQQAQDLVSCLGGPVLSGVCRRLAADFR
HCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMLWLDELQKLGADVEVCHVVAVGAK
SKSLT
Download this sequence
in fasta format
Download all sequences for 3.1.4.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
648010
Li R.,Fan W.,Tian G.,Zhu H.,He L.,Cai J.,Huang Q.,Cai Q.,Li B.,Bai Y.,Zhang Z.,Zhang Y.,Wang W.,Li J.,Wei F.,Li H.,Jian M.,Li J.,Zhang Z.,Nielsen R.,Li D.,Gu W.,Yang Z.,Xuan Z.,Ryder O.A.,Leung F.C.,Zhou Y.,Cao J.,Sun X.,Fu Y.,Fang X.,Guo X.,Wang B.,Hou R.,Shen F.,Mu B.,Ni P.,Lin R.,Qian W.,Wang G.,Yu C.,Nie W.,Wang J.,Wu Z.,Liang H.,Min J.,Wu Q.,Cheng S.,Ruan J.,Wang M.,Shi Z.,Wen M.,Liu B.,Ren X.,Zheng H.,Dong D.,Cook K.,Shan G.,Zhang H.,Kosiol C.,Xie X.,Lu Z.,Zheng H.,Li Y.,Steiner C.C.,Lam T.T.,Lin S.,Zhang Q.,Li G.,Tian J.,Gong T.,Liu H.,Zhang D.,Fang L.,Ye C.,Zhang J.,Hu W.,Xu A.,Ren Y.,Zhang G.,Bruford M.W.,Li Q.,Ma L.,Guo Y.,An N.,Hu Y.,Zheng Y.,Shi Y.,Li Z.,Liu Q.,Chen Y.,Zhao J.,Qu N.,Zhao S.,Tian F.,Wang X.,Wang H.,Xu L.,Liu X.,Vinar T.,Wang Y.,Lam T.W.,Yiu S.M.,Liu S.,Zhang H.,Li D.,Huang Y.,Wang X.,Yang G.,Jiang Z.,Wang J.,Qin N.,Li L.,Li J.,Bolund L.,Kristiansen K.,Wong G.K.,Olson M.,Zhang X.,Li S.,Yang H.,Wang J.,Wang J.
The sequence and de novo assembly of the giant panda genome.
Nature
463
311-317
2010