Sequence of 5NTD_RHIMP

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
UDP-sugar diphosphatase
P52307
Rhipicephalus microplus
580
63460
Reaction
UDP-sugar + H2O = UMP + alpha-D-aldose 1-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>P52307|UDP-sugar diphosphatase|EC 3.6.1.45|Rhipicephalus microplus|Swiss-Prot
GRLLACLLLPGLAATDFTATVLHTNDVHGRFEQITASGTRCTKQAAEAQQCVGGIARQKT
VVSQAAASGANVLFLNAGDYYQGSIWYYVLGAPIVAEAVNYLAHDAMALGNHEFDRGAEG
LVPLLTESRVPIVGCNVDFSEEPTLKPLQPKPSVVVERAGIKIGLIGYTTMNTTYLSSPG
KVRFTDEAECIQREAQRLRREEGVQVIIAVGHSGVPRDLEICERVPEVSLVVGGHTHTFL
YSGPTENGRVSGDKPQGPYPIVVDRAADSRCLVVQDFYMGKYMGNISITWNQRGEVVRWS
GQPVLLDRSIPEDPDGIALLDRYRDRVAQSQASVVAESKVLLDGDKNRCRLDECNLGNLV
MDAFLKKMASLPSPQASWTRVAAVIANAGGIRASIDEQSTGGRITFEDVVNVLPFGNTLV
EMNVTGAQLKGLLEHGVHRHDVKGYVPPAELVLAAGLRVVYDIQREPYDRVVEAHILCTE
CRVPRYEPLEYARQYRIAALSYIVHGGDNFDFSFVKPKDMYDTGFQDAEIVMKYMNSTSP
ITTALDGRVTFLKTNQASDACLNLASPFLVLLVLVVFYHL
Download this sequence
in fasta format
Download all sequences for 3.6.1.45
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
626353
Liyou N.,Hamilton S.,Elvin C.,Willadsen P.
Cloning and expression of ecto 5-nucleotidase from the cattle tick Boophilus microplus.
Insect Mol. Biol.
8
257-266
1999
626354
Willadsen P.,Riding G.A.,Jarmey J.,Atkins A.
The nucleotidase of Boophilus microplus and its relationship to enzymes from the rat and Escherichia coli.
Insect Biochem. Mol. Biol.
23
291-295
1993