Sequence of A0A1E2WX57_9NOSO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
2-methylisocitrate dehydratase
A0A1E2WX57
Nostoc sp. KVJ20
876
94633
Reaction
(2S,3R)-3-Hydroxybutane-1,2,3-tricarboxylate = (Z)-but-2-ene-1,2,3-tricarboxylate + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1E2WX57|2-methylisocitrate dehydratase|EC 4.2.1.99|Nostoc sp. KVJ20|TrEMBL
MLEQYRKHVAERAALGIPPLPLDAKQTSELCELLKNPPKGQEEILLHLLSDRVSPGVDPA
AYVKAGFLTAIAKEEITSPLIAPIEAVQLLGTMIGGYNVQSLIDLLQLPTVSLSDSSETP
LVMGGQGKEPISAYAANALSKILLVYDAYHDVLELSKTNPFAKLVIDSWAEAEWFTMRPT
VPEAITVTVFKVPGETNTDDLSPAQSATTRPDIPLHALVMLESRQPGSLQTIAELKKKGH
PVAYVGDVVGTGSSRKSAINSVLWHMGNDIPFVPNKRAGGYVLGGAIAPIFFNTAEDAGA
LPIQCDVTKLETGMVITIHPYKGEITNEAGEVISTFNLKPDTILDEVRAGGRIPLLIGRT
LTDKTRLALGLEPSTVFTRPQQAFDTGKGYSLAQKMVGKACGLPGVRPGTSCEPIITTVG
SQDTTGPMTRDELKELACLGFSADLVIQSFCHTAAYPKPVDIKTHHELPDFFASRGGVAL
RPGDGIIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAAALGVMPLDMPESV
LVRFKGELQPGITLRDVVNAIPYVAIQKGLLTAEKQNKKNIFSGRILEIEGLPDLKVEQA
FELTDASAERSCAGCTIKLSVETISEYLRSNVALLKNMIARGYHDPRTMLRRVAKMEEWL
ANPVLLEGDADAEYAEIIEIDLNEIKEPIVAAPNDPDNVKLLSEVANDPVQEVFVGSCMT
NIGHYRATAKVLEGAGEVKTRLWIAPPTRMDEHQLKEEGVYSVFGAAGARTEMPGCSLCM
GNQARVADGTTVFSTSTRNFNNRMGKDARVYLGSAELAAVCALLGRLPTVQEYLDIVASR
IEPFADDLYRYLNFDQIAGFEDEGRVISQEEQALLV
Download this sequence
in fasta format
Download all sequences for 4.2.1.99
in fasta format
in csv (Excel, OpenOffice) format