Sequence of PNMT_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
phenylethanolamine N-methyltransferase
P10937
Rattus norvegicus
285
31670
Reaction
S-adenosyl-L-methionine + phenylethanolamine = S-adenosyl-L-homocysteine + N-methylphenylethanolamine
Sequences with same EC No.
Sequence
show sequence in normal format
>P10937|phenylethanolamine N-methyltransferase|EC 2.1.1.28|Rattus norvegicus|Swiss-Prot
MDRGSDPKHTAGMDSDSDPGQAEVALAYQRFEPRAYLRNNYAPPRGDLSNPDGVGPWKLR
CMAQVFATGEVSGQVLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELGLWLREEPG
AFDWSVYSQHVCLIEDKGESWQEKERQLRARVKRVLPIDVHKPQPLGASGLAPLPADALV
SAFCLEAVSPDLPSFRQALYHITTLLRPGGNLLFIGALEESWYLAGEARLSVVPVSEEEV
REALVCSGYEVRDLRTYIMPAHLRTGVDDVKGIFFAWAQKIEVQV
Download this sequence
in fasta format
Download all sequences for 2.1.1.28
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
567529
Suh Y.H.,Chun Y.S.,Lee I.S.,Kim S.S.,Choi W.,Chong Y.H.,Hong L.,Kim S.H.,Park C.W.,Kim C.G.
Complete nucleotide sequence and tissue-specific expression of the rat phenylethanolamine N-methyltransferase gene.
J. Neurochem.
63
1603-1608
1994
567530
Koike G.,Jacob H.J.,Krieger J.E.,Szpirer C.,Hoehe M.R.,Horiuchi M.,Dzau V.J.
Investigation of the phenylethanolamine N-methyltransferase gene as a candidate gene for hypertension.
Hypertension
26
595-601
1995
567531
Weisberg E.P.,Baruchin A.,Stachowiak M.K.,Stricker E.M.,Zigmond M.J.,Kaplan B.B.
Isolation of a rat adrenal cDNA clone encoding phenylethanolamine N-methyltransferase and cold-induced alterations in adrenal PNMT mRNA and protein.
Brain Res. Mol. Brain Res.
6
159-166
1989
567532
Mezey E.
Cloning of the rat adrenal medullary phenylethanolamine-N-methyltransferase.
Nucleic Acids Res.
17
2125-2125
1989