Sequence of P4HA3_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
procollagen-proline 4-dioxygenase
Q6W3E9
Rattus norvegicus
544
61165
Reaction
procollagen L-proline + 2-oxoglutarate + O2 = procollagen trans-4-hydroxy-L-proline + succinate + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q6W3E9|procollagen-proline 4-dioxygenase|EC 1.14.11.2|Rattus norvegicus|Swiss-Prot
MGPGARLAALLVLLKLGVGDPAAAAGREDTFSALTSVARALAPERRLLGTLRRYLRGEEA
RLRDLTRFYDKVLSLHEDLKIPVVNPLLVFTLIKRLPSDWRNVVHSLEATENIRAPKDGY
EKVEQDLPAFEDLEGAARALMRLQDAYMLNVKGLAQGVFQRVTGSSITDLYSPRQLFSLT
ADDCFQVGKVAYDTGDYYHAIPWLEEAVSLFRRSYGEWKTEDEASLEDALDYLAFACYQV
GNVSCALSLSREFLVYSPDNKRMARNVLKYERLLAENGHLMAAETAIQRPNVPHLQTRDT
YEGLCQTLGSQPTHYQIPSLYCSYETNSSPYLLLQPARKEVIHLRPLVALYHDFVSDEEA
QKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPVLVTLDRRIAALTGLDIQP
PYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYKMKSGNRAATLMIYLSSVEAGGATAFIY
GNFSVPVVKNAALFWWNLHRSGEGDDDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPCDT
NPED
Download this sequence
in fasta format
Download all sequences for 1.14.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
562558
Kukkola L.,Hieta R.,Kivirikko K.I.,Myllyharju J.
Identification and characterization of a third human, rat, and mouse collagen prolyl 4-hydroxylase isoenzyme.
J. Biol. Chem.
278
47685-47693
2003