Sequence of A0A0X3U332_9RHOB

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
thymidylate synthase (FAD)
A0A0X3U332
Ruegeria profundi
303
34857
Reaction
5,10-methylenetetrahydrofolate + dUMP + NADPH + H+ = dTMP + tetrahydrofolate + NADP+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0X3U332|thymidylate synthase (FAD)|EC 2.1.1.148|Ruegeria profundi|TrEMBL
MPLSSDQLAEIEAQRAQSHPTRRVVAAGMEEHLYTAHQVLDHGFVRVIDYMGDDAAICQA
ARVSYGKGTKSVQNDEGLIRYLMRHWHSTPFEMCEVKLHVKLPVFVARQWIRHRTANVNE
YSARYSILDREFYIPAPDHVAAQSEVNNQGRGSALEGEEAARVLDILKADSARCYDNYEA
MISQDGQQGLARELARMNLPANIYTQWYWKVDLHNLFHFLRLRADPHAQYEIRVYAEIMC
KIVADWVPFAYKAFEDYRLGAVNLSAQMVDCLRRMLTGEAVTQENSGMTAREWREFEAVI
RKA
Download this sequence
in fasta format
Download all sequences for 2.1.1.148
in fasta format
in csv (Excel, OpenOffice) format