Sequence of A2QU38_ASPNC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
indoleamine-pyrrole 2,3-dioxygenase
A2QU38
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
488
54374
Reaction
Sequences with same EC No.
Sequence
show sequence in normal format
>A2QU38|indoleamine-pyrrole 2,3-dioxygenase|EC 1.13.11.42|Aspergillus niger (strain CBS 513.88 / FGSC A1513)|TrEMBL
MLPPIPALADYGISADHGFLPPEPPLEILPDPYYAKWEWIVSNLQALLTSRRIREVVDHM
SKLSTSYLQSENEWRRAYVVLVFMLHGYVWGGSKPAEKIPPQLTVPLFDVCEHLGLPPVA
TYAGVCLWNYKPIFPEESIDDLRNLDTINTFTGSLDEKWFYLVSVAIEARGAPSIPLVLQ
AIAAARAGNSLVVTECLQRLAEVLDEVGSLLERMYEHCDPYVFYHRIRPYLAGSKNMADA
GLPHGLLYDYGNGQPEYRQYGGGSNAQSSLIQFFDIALGIEHRPTGETRPSSTPMKDEKE
GVVGAPRHGFIQEMRTYMPAAHRRFLEHVNAVANIRQYVEARRSDKALCIAYDACLSMLR
AMRDKHIQIVSRYIIIQSRDARPSRPARATSPKRAINLATARHGEKPDSKKLRGTGGTAL
IPFLKQARDETGEPAIDAWARRLLSTGPSESSFAALSKVDEDHDGHLQVVGLSGTWAADD
SEGGICHW
Download this sequence
in fasta format
Download all sequences for 1.13.11.42
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
97913811
Pel H.J.,de Winde J.H.,Archer D.B.,Dyer P.S.,Hofmann G.,Schaap P.J.,Turner G.,de Vries R.P.,Albang R.,Albermann K.,Andersen M.R.,Bendtsen J.D.,Benen J.A.,van den Berg M.,Breestraat S.,Caddick M.X.,Contreras R.,Cornell M.,Coutinho P.M.,Danchin E.G.,Debets A.J.,Dekker P.,van Dijck P.W.,van Dijk A.,Dijkhuizen L.,Driessen A.J.,d'Enfert C.,Geysens S.,Goosen C.,Groot G.S.,de Groot P.W.,Guillemette T.,Henrissat B.,Herweijer M.,van den Hombergh J.P.,van den Hondel C.A.,van der Heijden R.T.,van der Kaaij R.M.,Klis F.M.,Kools H.J.,Kubicek C.P.,van Kuyk P.A.,Lauber J.,Lu X.,van der Maarel M.J.,Meulenberg R.,Menke H.,Mortimer M.A.,Nielsen J.,Oliver S.G.,Olsthoorn M.,Pal K.,van Peij N.N.,Ram A.F.,Rinas U.,Roubos J.A.,Sagt C.M.,Schmoll M.,Sun J.,Ussery D.,Varga J.,Vervecken W.,van de Vondervoort P.J.,Wedler H.,Wosten H.A.,Zeng A.P.,van Ooyen A.J.,Visser J.,Stam H.
Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88.
Nat. Biotechnol.
25
221-231
2007